Structure of PDB 2zbc Chain H |
>2zbcH (length=81) Species: 273063 (Sulfurisphaera tokodaii str. 7) [Search protein sequence] |
ASAIVLINTDAGGEDEVFERLKSMSEVTEVHVVYGVYDIVVKVEADSMDK LKDFVTNTIRKLPKVRSTLTMIIVEGKSLVK |
|
PDB | 2zbc Crystal structure of STS042, a stand-alone RAM module protein, from hyperthermophilic archaeon Sulfolobus tokodaii strain7 |
Chain | H |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ILE |
H |
T69 T71 |
T68 T70 |
|
|
|