Structure of PDB 2ykr Chain H

Receptor sequence

>2ykrH (length=129) Species: 668369 (Escherichia coli DH5[alpha])

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA

3D structure

• PDB: 2ykr Structural Basis for the Function of a Small Gtpase Rsga on the 30S Ribosomal Subunit Maturation Revealed by Cryoelectron Microscopy.
• Chain: H
• Resolution: 9.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	S1 M2 Q3 D4 A7 D8 T11 R12 R14 N15 S29 K30 L31 D53 T54 K55 R76 R79 P80 R83 Y85 K86 R87 K88 L91 S104 T105 S106 K107 G108 L120 G121 G122 E123	S1 M2 Q3 D4 A7 D8 T11 R12 R14 N15 S29 K30 L31 D53 T54 K55 R76 R79 P80 R83 Y85 K86 R87 K88 L91 S104 T105 S106 K107 G108 L120 G121 G122 E123

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0043488 regulation of mRNA stability

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2ykr, PDBe:2ykr, PDBj:2ykr
• PDBsum: 2ykr
• PubMed: 21788480
• UniProt: P0A7W7|RS8_ECOLI Small ribosomal subunit protein uS8 (Gene Name=rpsH)