Structure of PDB 2wsc Chain H

Receptor sequence
>2wscH (length=69) Species: 3562 (Spinacia oleracea) [Search protein sequence]
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLIL
GGGSLLTYVSANAPQDVLP
3D structure
PDB2wsc Structure Determination and Improved Model of Plant Photosystem I.
ChainH
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FRU H A72 P73 A63 P64
BS02 CLA H L65 S69 L56 S60
BS03 CLA H S34 Q36 S25 Q27
Gene Ontology
Molecular Function
GO:0060090 molecular adaptor activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wsc, PDBe:2wsc, PDBj:2wsc
PDBsum2wsc
PubMed19923216
UniProtP22179|PSAH_SPIOL Photosystem I reaction center subunit VI, chloroplastic (Gene Name=PSAH)

[Back to BioLiP]