Structure of PDB 2w6j Chain H

Receptor sequence
>2w6jH (length=83) Species: 9913 (Bos taurus) [Search protein sequence]
SFTFASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVTLDMLDLGA
AKANLEKAQSELLGAADEATRAEIQIRIEANEA
3D structure
PDB2w6j Improving diffraction by humidity control: a novel device compatible with X-ray beamlines.
ChainH
Resolution3.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.3.14: Transferred entry: 7.1.2.2.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide H L58 P60 F76 S78 S79 G80 E95 E96 L103 D104 N111 A126 A129 E130 Q132 I133 R134 E136 L20 P22 F28 S30 S31 G32 E38 E39 L46 D47 N54 A69 A72 E73 Q75 I76 R77 E79
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Biological Process
GO:0006754 ATP biosynthetic process
GO:0009060 aerobic respiration
GO:0015986 proton motive force-driven ATP synthesis
GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005740 mitochondrial envelope
GO:0005743 mitochondrial inner membrane
GO:0045259 proton-transporting ATP synthase complex
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2w6j, PDBe:2w6j, PDBj:2w6j
PDBsum2w6j
PubMed19966409
UniProtP05630|ATPD_BOVIN ATP synthase subunit delta, mitochondrial (Gene Name=ATP5F1D)

[Back to BioLiP]