Structure of PDB 2vi5 Chain H

Receptor sequence
>2vi5H (length=148) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
LDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEI
PVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPI
ANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
3D structure
PDB2vi5 A New Series of N-[2,4-Dioxo-6-D-Ribitylamino-1,2, 3,4-Tetrahydropyrimidin-5-Yl]Oxalamic Acid Derivatives as Inhibitors of Lumazine Syntase and Riboflavin Synthase: Design, Synthesis, Biochemical Evaluation, Crystallography and Mechanistic Implications.
ChainH
Resolution2.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H89
Catalytic site (residue number reindexed from 1) H77
Enzyme Commision number 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 Y19 H A113 N114 A101 N102 MOAD: Ki=110uM
BS02 Y19 H W27 G58 A59 I60 E61 V81 V82 I83 W15 G46 A47 I48 E49 V69 V70 I71 MOAD: Ki=110uM
Gene Ontology
Molecular Function
GO:0000906 6,7-dimethyl-8-ribityllumazine synthase activity
GO:0016740 transferase activity
Biological Process
GO:0009231 riboflavin biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0009349 riboflavin synthase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vi5, PDBe:2vi5, PDBj:2vi5
PDBsum2vi5
PubMed18331058
UniProtP9WHE9|RISB_MYCTU 6,7-dimethyl-8-ribityllumazine synthase (Gene Name=ribH)

[Back to BioLiP]