Structure of PDB 2pdo Chain H |
>2pdoH (length=140) Species: 198215 (Shigella flexneri 2a str. 2457T) [Search protein sequence] |
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEV NGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGC PKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDEE |
|
PDB | 2pdo Crystal Structure of the Putative Acetyltransferase of GNAT Family from Shigella flexneri |
Chain | H |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
H |
E124 H125 |
E124 H125 |
|
|
|
|