Structure of PDB 2otl Chain H

Receptor sequence

>2otlH (length=160) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLI
VEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKD
GMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSC
RIDSSPAGNA

3D structure

PDB

2otl The Structures of Antibiotics Bound to the E Site Region of the 50 S Ribosomal Subunit of Haloarcula marismortui: 13-Deoxytedanolide and Girodazole.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K1 A3 M5 R7 K11 P12 A13 Y14 T15 R16 R17 E18 Y19 K32 R58 S61 A64 R71 R88 K89 F90 H92 R96 E97 M113 R114 A115 A116 F117 G118 R151 R152 Y154 N155 K156 I157 T158 S160	K1 A3 M5 R7 K11 P12 A13 Y14 T15 R16 R17 E18 Y19 K32 R58 S61 A64 R71 R88 K89 F90 H92 R96 E97 M102 R103 A104 A105 F106 G107 R140 R141 Y143 N144 K145 I146 T147 S149

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2otl, PDBe:2otl, PDBj:2otl
PDBsum	2otl
PubMed	17321546
UniProt	P60617\|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)

[Back to BioLiP]