Structure of PDB 2o01 Chain H |
>2o01H (length=75) Species: 3562 (Spinacia oleracea) [Search protein sequence] |
WDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSA NAPQDVLPITRGPQQPPKLGPRGKI |
|
PDB | 2o01 The structure of a plant photosystem I supercomplex at 3.4 A resolution. |
Chain | H |
Resolution | 3.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CLA |
H |
N33 S34 Q36 |
N13 S14 Q16 |
|
|
|
|