Structure of PDB 2nqb Chain H

Receptor sequence
>2nqbH (length=93) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KRKESYAIYIYTVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
3D structure
PDB2nqb Comparative analysis of nucleosome structures from different species.
ChainH
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H K1429 K1431 S1433 I1436 Y1437 K1 K3 S5 I8 Y9
BS02 dna H R1430 S1452 S1453 R1483 S1484 T1485 R2 S24 S25 R55 S56 T57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2nqb, PDBe:2nqb, PDBj:2nqb
PDBsum2nqb
PubMed
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]