Structure of PDB 2j4e Chain H

Receptor sequence
>2j4eH (length=184) Species: 9606 (Homo sapiens) [Search protein sequence]
ASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEI
SIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQ
LLAGFEDKSAYALCTFALSTQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQ
PDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFG
3D structure
PDB2j4e Crystal Structure of Human Inosine Triphosphatase: Substrate Binding and Implication of the Inosine Triphosphatase Deficiency Mutation P32T.
ChainH
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.9: nucleotide diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ITT H T14 G15 N16 K19 E44 K56 T73 I88 K89 F149 W151 D152 K172 H177 R178 T12 G13 N14 K17 E42 K54 T71 I86 K87 F143 W145 D146 K166 H171 R172
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0016787 hydrolase activity
GO:0035870 dITP diphosphatase activity
GO:0036220 ITP diphosphatase activity
GO:0036222 XTP diphosphatase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0047429 nucleoside triphosphate diphosphatase activity
Biological Process
GO:0006193 ITP catabolic process
GO:0009117 nucleotide metabolic process
GO:0009143 nucleoside triphosphate catabolic process
GO:0009204 deoxyribonucleoside triphosphate catabolic process
GO:0051276 chromosome organization
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2j4e, PDBe:2j4e, PDBj:2j4e
PDBsum2j4e
PubMed17138556
UniProtQ9BY32|ITPA_HUMAN Inosine triphosphate pyrophosphatase (Gene Name=ITPA)

[Back to BioLiP]