Structure of PDB 2hzs Chain H

Receptor sequence
>2hzsH (length=230) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VQQLSLFGSIGDDGYDLLISTLTTISGNPPLLYNSLCTVWKPNPSYDVEN
VNSRNQLVEPNRIKLSKEVPFSYLIDETMMDKPLNFRISCSPWSLQISDI
PAAGNNRSVSMQTIAETIILSSAGKNSSVSSLMNGLGYVFEFQYLTIGVK
FFMKHGLILELQKIWQIEEAGNSQITSGGFLLKAYINVSRGTDIDRINYT
ETVLMNLKKELQGYIELSVPDRQSMDSRVA
3D structure
PDB2hzs Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
ChainH
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide H F8 S10 Q183 F213 Y215 Q237 I246 T247 F251 P291 D292 Q294 S295 M296 S298 F7 S9 Q112 F142 Y144 Q166 I175 T176 F180 P220 D221 Q223 S224 M225 S227
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006369 termination of RNA polymerase II transcription
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0034605 cellular response to heat
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2hzs, PDBe:2hzs, PDBj:2hzs
PDBsum2hzs
PubMed16964259
UniProtP32585|MED18_YEAST Mediator of RNA polymerase II transcription subunit 18 (Gene Name=SRB5)

[Back to BioLiP]