Structure of PDB 2hxc Chain H

Receptor sequence

>2hxcH (length=110) Species: 511 (Alcaligenes faecalis)

EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISWIGTCHNPHDGK
DYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFH
CTTSVLVGLA

3D structure

• PDB: 2hxc Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
• Chain: H
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 1.4.9.2: aralkylamine dehydrogenase (azurin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ABN	H	D84 X109 V158 N159	D14 X39 V88 N89

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors
• GO:0030059 aralkylamine dehydrogenase (azurin) activity

Biological Process

• GO:0009308 amine metabolic process

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2hxc, PDBe:2hxc, PDBj:2hxc
• PDBsum: 2hxc
• PubMed: 17005560
• UniProt: P84887|AAUA_ALCFA Aralkylamine dehydrogenase light chain (Gene Name=aauA)