Structure of PDB 2h9t Chain H

Receptor sequence

>2h9tH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETPSV
LQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPF
VMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE

3D structure

• PDB: 2h9t Structural and thermodynamic analysis of thrombin:suramin interaction in solution and crystal phases.
• Chain: H
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 W29 S48 D116 H119 P120 V121 C122 Y134 K135 G136 R137 N159 K202 P204 N205 R206 W207	E8 I9 G10 M11 W14 S34 D113 H116 P117 V118 C119 Y134 K135 G136 R137 N155 K203 P205 N208 R209 W210
BS02	peptide	H	H57 Y60A N98 L99 D189 A190 C191 G193 S195 S214 W215 G216	H43 Y47 N95 L96 D190 A191 C192 G194 S196 S217 W218 G219
BS03	SVR	H	P92 R93 R101 W237 K240 V241 D243 Q244 G246 E247	P88 R89 R98 W240 K243 V244 D246 Q247 G249 E250	PDBbind-CN: -logKd/Ki=4.70,IC50=20uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:2h9t, PDBe:2h9t, PDBj:2h9t
• PDBsum: 2h9t
• PubMed: 19332154
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)