Structure of PDB 2h1o Chain H |
>2h1oH (length=63) Species: 485 (Neisseria gonorrhoeae) [Search protein sequence] |
ASVVIRNLSEATHNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSM LASIGQEIGGVEL |
|
PDB | 2h1o Structure of FitAB from Neisseria gonorrhoeae bound to DNA reveals a tetramer of toxin-antitoxin heterodimers containing pin domains and ribbon-helix-helix motifs. |
Chain | H |
Resolution | 3.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
H |
S27 T28 E29 R33 |
S26 T27 E28 R32 |
|
|
|
|