Structure of PDB 2bx9 Chain H

Receptor sequence

>2bx9H (length=53) Species: 1423 (Bacillus subtilis)

MVIATDDLEVACPKCERAGEIEGTPCPACSGKGVILTAQGYTLLDFIQKH
LNK

3D structure

• PDB: 2bx9 Crystal Structure of Bacillus Subtilis Anti-Trap Protein, an Antagonist of Trap/RNA Interaction.
• Chain: H
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	H	C12 C15 C26 C29	C12 C15 C26 C29

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0042802 identical protein binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:2bx9, PDBe:2bx9, PDBj:2bx9
• PDBsum: 2bx9
• PubMed: 16306262
• UniProt: O31466|RTPA_BACSU Tryptophan RNA-binding attenuator protein inhibitory protein (Gene Name=rtpA)