Structure of PDB 2bvr Chain H

Receptor sequence

>2bvrH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEKGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 2bvr Discovery of Thrombin Inhibitor Fragments from Chemical Microarray Screening
• Chain: H
• Resolution: 1.25 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	F34 L65 R73 T74 R75 Y76 K81 I82 F245	F19 L60 R68 T69 R70 Y71 K77 I78 F250
BS02	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N157 M204 K205 N210 R211 W212
BS03	4CP	H	W60D A190 C191 E192 V213 W215 G216 G219 C220 G226 F227	W50 A193 C194 E195 V218 W220 G221 G223 C224 G231 F232	PDBbind-CN: -logKd/Ki=3.70,Ki=200uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:2bvr, PDBe:2bvr, PDBj:2bvr
• PDBsum: 2bvr
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)