Structure of PDB 2agw Chain H

Receptor sequence

>2agwH (length=119) Species: 511 (Alcaligenes faecalis)

SLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISWI
GTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNW
CMANENSTFHCTTSVLVGL

3D structure

• PDB: 2agw Atomic description of an enzyme reaction dominated by proton tunneling
• Chain: H
• Resolution: 1.45 Å

Enzymatic activity

• Enzyme Commision number: 1.4.9.2: aralkylamine dehydrogenase (azurin).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TSS	H	D84 X109 N156 V158	D24 X49 N96 V98

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors
• GO:0030059 aralkylamine dehydrogenase (azurin) activity

Biological Process

• GO:0009308 amine metabolic process

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:2agw, PDBe:2agw, PDBj:2agw
• PDBsum: 2agw
• PubMed: 16614214
• UniProt: P84887|AAUA_ALCFA Aralkylamine dehydrogenase light chain (Gene Name=aauA)