Structure of PDB 1uvu Chain H

Receptor sequence

>1uvuH (length=244) Species: 9913 (Bos taurus)

IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETVQP
SVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGG
PFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKWKVI

3D structure

• PDB: 1uvu Enzyme flexibility, solvent and 'weak' interactions characterize thrombin-ligand interactions: implications for drug design.
• Chain: H
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	Q20 E23 V24 G25 L26 P28 W29 D116 H119 P120 C122 L129C F134 K135 R137 N159 K202 N205 R206 W207	Q5 E8 V9 G10 L11 P13 W14 D113 H116 P117 C119 L129 F134 K135 R137 N157 K205 N210 R211 W212
BS02	DCH	H	H57 D189 A190 E192 S195 S214 W215 G216 G219 C220	H43 D192 A193 E195 S198 S219 W220 G221 G223 C224	PDBbind-CN: -logKd/Ki=5.00,Ki=10uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1uvu, PDBe:1uvu, PDBj:1uvu
• PDBsum: 1uvu
• PubMed: 8939759
• UniProt: P00735|THRB_BOVIN Prothrombin (Gene Name=F2)