Structure of PDB 1tnz Chain H

Receptor sequence
>1tnzH (length=346) Species: 10116 (Rattus norvegicus) [Search protein sequence]
LDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVV
NKDDIIEWIYSLQVLPTEDRSNLDRCGFRGSSYLGIPFNPSKNPGTAHPY
DSGHIAMTYTGLSCLIILGDDLSRVDKEACLAGLRALQLEDGSFCAVPEG
SENDMRFVYCASCICYMLNNWSGMDMKKAISYIRRSMSYDNGLAQGAGLE
SHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKP
VDTCYSFWVGATLKLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHP
DALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKT
3D structure
PDB1tnz Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.
ChainH
Resolution2.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H219 R263 K266 D269 C271 Y272 K311 D318 H321
Catalytic site (residue number reindexed from 1) H202 R246 K249 D252 C254 Y255 K294 D301 H304
Enzyme Commision number 2.5.1.59: protein geranylgeranyltransferase type I.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide H A123 R173 K311 L320 H321 A106 R156 K294 L303 H304
BS02 ZN H D269 C271 H321 D252 C254 H304
BS03 MGM H F53 R173 H219 G221 R263 K266 Y272 W275 F36 R156 H202 G204 R246 K249 Y255 W258
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004659 prenyltransferase activity
GO:0004661 protein geranylgeranyltransferase activity
GO:0004662 CAAX-protein geranylgeranyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0008318 protein prenyltransferase activity
GO:0036094 small molecule binding
GO:0042277 peptide binding
GO:0046872 metal ion binding
GO:1901363 heterocyclic compound binding
Biological Process
GO:0008284 positive regulation of cell population proliferation
GO:0018344 protein geranylgeranylation
GO:0034097 response to cytokine
GO:0045787 positive regulation of cell cycle
GO:0051771 negative regulation of nitric-oxide synthase biosynthetic process
Cellular Component
GO:0005953 CAAX-protein geranylgeranyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1tnz, PDBe:1tnz, PDBj:1tnz
PDBsum1tnz
PubMed15451670
UniProtP53610|PGTB1_RAT Geranylgeranyl transferase type-1 subunit beta (Gene Name=Pggt1b)

[Back to BioLiP]