Structure of PDB 1tmb Chain H

Receptor sequence

>1tmbH (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE

3D structure

• PDB: 1tmb Molecular basis for the inhibition of human alpha-thrombin by the macrocyclic peptide cyclotheonamide A.
• Chain: H
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 I47 S48 D49 D116 H119 P120 V121 C122 L123 Y134 K135 R137 N159 K202 P204 R206 W207	E8 G10 M11 P13 W14 I33 S34 D35 D113 H116 P117 V118 C119 L120 Y134 K135 R137 N157 K205 P207 R211 W212
BS02	peptide	H	F34 K36 R73 T74 R75 Y76 K81 I82	F19 K21 R68 T69 R70 Y71 K77 I78
BS03	peptide	H	L40 L41 H57 Y60A W60D D189 A190 C191 E192 G193 D194 S195 S214 W215 G216	L26 L27 H43 Y47 W50 D192 A193 C194 E195 G196 D197 S198 S219 W220 G221

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1tmb, PDBe:1tmb, PDBj:1tmb
• PDBsum: 1tmb
• PubMed: 8367461
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)