Structure of PDB 1thr Chain H

Receptor sequence

>1thrH (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
GE

3D structure

• PDB: 1thr Structures of thrombin complexes with a designed and a natural exosite peptide inhibitor.
• Chain: H
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	I16 E23 I24 G25 M26 P28 W29 D116 H119 P120 V121 C122 Y134 K135 R137 N159 K202 R206 W207	I1 E8 I9 G10 M11 P13 W14 D113 H116 P117 V118 C119 Y134 K135 R137 N157 K205 R211 W212
BS02	peptide	H	F34 R73 T74 Y76 K81 I82 M84 K110 P111 V112	F19 R68 T69 Y71 K77 I78 M80 K107 P108 V109

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1thr, PDBe:1thr, PDBj:1thr
• PDBsum: 1thr
• PubMed: 8376390
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)