Structure of PDB 1sb1 Chain H

Receptor sequence

>1sb1H (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 1sb1 Novel non-covalent thrombin inhibitors incorporating P(1) 4,5,6,7-tetrahydrobenzothiazole arginine side chain mimetics
• Chain: H
• Resolution: 1.9 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 F114 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 G10 M11 P13 W14 F111 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 R210 W211
BS02	peptide	H	F34 R73 T74 R75 Y76 K81 I82	F19 R68 T69 R70 Y71 K77 I78
BS03	165	H	H57 Y60A W60D N98 I174 D189 A190 S195 W215 G216 E217 G219 R221A	H43 Y47 W50 N95 I171 D191 A192 S197 W219 G220 E221 G222 R225	MOAD: Ki=128nM PDBbind-CN: -logKd/Ki=6.89,Ki=0.128uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1sb1, PDBe:1sb1, PDBj:1sb1
• PDBsum: 1sb1
• PubMed: 15051174
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)