Structure of PDB 1s5l Chain H

Receptor sequence
>1s5lH (length=53) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence]
LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWK
ALG
3D structure
PDB1s5l Architecture of the Photosynthetic Oxygen-Evolving Center
ChainH
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA H T26 M30 F33 L36 F37 T14 M18 F21 L24 F25
BS02 CLA H F37 L38 F25 L26
BS03 CLA H F37 F40 I44 Y48 F25 F28 I32 Y36
BS04 CLA H Y48 N49 Y36 N37
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1s5l, PDBe:1s5l, PDBj:1s5l
PDBsum1s5l
PubMed14764885
UniProtQ8DJ43|PSBH_THEVB Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]