Structure of PDB 1qbv Chain H

Receptor sequence

>1qbvH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 1qbv Structural analysis of thrombin complexed with potent inhibitors incorporating a phenyl group as a peptide mimetic and aminopyridines as guanidine substitutes.
• Chain: H
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 R210 W211
BS02	peptide	H	F34 Q38 L65 R67 R73 T74 Y76 K81 I82 M84	F19 Q24 L60 R62 R68 T69 Y71 K77 I78 M80
BS03	PPX	H	Y60A E97A D189 A190 S195 W215 G216 G219 G226	Y47 E94 D191 A192 S197 W219 G220 G222 G230	MOAD: Ki=4100nM PDBbind-CN: -logKd/Ki=5.39,Ki=4100nM BindingDB: Ki=4100nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1qbv, PDBe:1qbv, PDBj:1qbv
• PDBsum: 1qbv
• PubMed: 9622548
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)