Structure of PDB 1q81 Chain H

Receptor sequence
>1q81H (length=119) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFV
AEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTD
AGAAATVLEEIADKVEELR
3D structure
PDB1q81 Structural Insights into Peptide Bond Formation
ChainH
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H K31 G32 T33 N34 E35 K38 R42 V54 Q55 I59 Q80 L89 V91 S93 A94 K31 G32 T33 N34 E35 K38 R42 V54 Q55 I59 Q80 L89 V91 S93 A94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1q81, PDBe:1q81, PDBj:1q81
PDBsum1q81
PubMed12185246
UniProtP12743|RL7A_HALMA Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]