Structure of PDB 1p3f Chain H

Receptor sequence
>1p3fH (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
KSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB1p3f Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
ChainH
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna H K1428 R1430 K1431 E1432 S1433 I1436 K1 R3 K4 E5 S6 I9
BS02 dna H K1428 S1429 R1430 S1453 R1483 S1484 T1485 K1 S2 R3 S26 R56 S57 T58
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1p3f, PDBe:1p3f, PDBj:1p3f
PDBsum1p3f
PubMed14739929
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]