Structure of PDB 1ogy Chain H

Receptor sequence
>1ogyH (length=126) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]
DAPRLTGADRPMSEVAAPPLPETITDDRRVGRNYPEQPPVIPHSIEGYQL
SVNANRCLECHRRQYSGLVAAPMISITHFQDREGQMLADVSPRRYFCTAC
HVPQTNAQPLVTNEFRDMLTLMPASN
3D structure
PDB1ogy Structural and Redox Plasticity in the Heterodimeric Periplasmic Nitrate Reductase
ChainH
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC H R30 P40 V41 I42 P43 H44 Y49 R57 C58 C61 H62 H102 R29 P39 V40 I41 P42 H43 Y48 R56 C57 C60 H61 H101
BS02 HEC H R33 P36 E37 Q38 P40 H62 M74 I75 H79 R95 C98 C101 H102 R32 P35 E36 Q37 P39 H61 M73 I74 H78 R94 C97 C100 H101
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
Biological Process
GO:0009061 anaerobic respiration
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ogy, PDBe:1ogy, PDBj:1ogy
PDBsum1ogy
PubMed14528294
UniProtQ53177|NAPB_CERS4 Periplasmic nitrate reductase, electron transfer subunit (Gene Name=napB)

[Back to BioLiP]