Structure of PDB 1nzq Chain H

Receptor sequence

>1nzqH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 1nzq D-Phe-Pro-Arg type thrombin inhibitors: unexpected selectivity by modification of the P1 moiety
• Chain: H
• Resolution: 2.18 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 I9 G10 M11 P13 W14 H116 P117 C119 Y134 K135 R137 N157 M204 K205 R211 W212
BS02	peptide	H	Q38 L40 R67 R73 T74 R75 Y76 I82	Q24 L26 R62 R68 T69 R70 Y71 I78
BS03	162	H	H57 Y60A W60D D189 A190 E192 S195 S214 W215 G216 E217 G219	H43 Y47 W50 D192 A193 E195 S198 S219 W220 G221 E222 G223	MOAD: ic50=11nM PDBbind-CN: -logKd/Ki=7.96,IC50=11nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1nzq, PDBe:1nzq, PDBj:1nzq
• PDBsum: 1nzq
• PubMed: 12781189
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)