Structure of PDB 1nrs Chain H

Receptor sequence

>1nrsH (length=252) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSG
GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ
FG

3D structure

• PDB: 1nrs Crystallographic structures of thrombin complexed with thrombin receptor peptides: existence of expected and novel binding modes.
• Chain: H
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 I9 G10 M11 W14 D113 H116 P117 C119 Y134 K135 R137 N158 M205 K206 N211 R212 W213
BS02	peptide	H	H57 Y60A W60D N98 D189 A190 S195 W215 G216 E217 G219	H43 Y47 W50 N95 D193 A194 S199 W221 G222 E223 G224
BS03	peptide	H	F34 R73 T74 R75 Y76 I82 M84	F19 R68 T69 R70 Y71 I78 M80

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1nrs, PDBe:1nrs, PDBj:1nrs
• PDBsum: 1nrs
• PubMed: 8136362
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)