Structure of PDB 1nrr Chain H

Receptor sequence

>1nrrH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 1nrr Crystallographic structures of thrombin complexed with thrombin receptor peptides: existence of expected and novel binding modes.
• Chain: H
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 I9 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 R210 W211
BS02	peptide	H	F34 R67 R73 T74 R75 Y76	F19 R62 R68 T69 R70 Y71
BS03	0G6	H	H57 Y60A L99 D189 A190 S195 W215 G216	H43 Y47 L96 D191 A192 S197 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1nrr, PDBe:1nrr, PDBj:1nrr
• PDBsum: 1nrr
• PubMed: 8136362
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)