Structure of PDB 1n3e Chain H

Receptor sequence

>1n3eH (length=151) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

TKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRR
WFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQA
NLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVL
D

3D structure

PDB

1n3e Flexible DNA Target Site Recognition by Divergent Homing Endonuclease Isoschizomers I-CreI and I-MsoI

Chain

Resolution

2.5 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G719 D720
Catalytic site (residue number reindexed from 1)	G17 D18
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	H	S732 Y733 K734 Q738 R768 R770 E780 I781 K816 K839	S30 Y31 K32 Q36 R66 R68 E78 I79 K114 K137
BS02	dna	H	D720 T746 Q747 K748 R751	D18 T44 Q45 K46 R49
BS03	dna	H	G719 D720 G721 S722 I724 Q726 K728 Q744 R770 A833 N836 D837 S838 K842 T843	G17 D18 G19 S20 I22 Q24 K26 Q42 R68 A131 N134 D135 S136 K140 T141

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1n3e, PDBe:1n3e, PDBj:1n3e
PDBsum	1n3e
PubMed	12758074
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]