Structure of PDB 1lhf Chain H

Receptor sequence

>1lhfH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 1lhf Kinetic and crystallographic studies of thrombin with Ac-(D)Phe-Pro-boroArg-OH and its lysine, amidine, homolysine, and ornithine analogs.
• Chain: H
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 P204 N205 R206 W207	E8 I9 G10 M11 W14 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 P206 N209 R210 W211
BS02	peptide	H	F34 Q38 R73 T74 R75 Y76	F19 Q24 R68 T69 R70 Y71
BS03	DI4	H	H57 W60D L99 I174 D189 A190 C191 S195 S214 W215 G216	H43 W50 L96 I171 D191 A192 C193 S197 S218 W219 G220	PDBbind-CN: -logKd/Ki=8.09,Ki=8.1nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1lhf, PDBe:1lhf, PDBj:1lhf
• PDBsum: 1lhf
• PubMed: 7893672
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)