Structure of PDB 1lhd Chain H

Receptor sequence

>1lhdH (length=249) Species: 9606 (Homo sapiens) [Search protein sequence]

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

PDB

1lhd Kinetic and crystallographic studies of thrombin with Ac-(D)Phe-Pro-boroArg-OH and its lysine, amidine, homolysine, and ornithine analogs.

Chain

Resolution

2.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 P204 R206 W207	E8 I9 G10 M11 W14 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 P206 R210 W211
BS02	peptide	H	F34 Q38 L40 R67 R73 T74 R75 Y76 I82	F19 Q24 L26 R62 R68 T69 R70 Y71 I78
BS03	DI2	H	H57 Y60A N98 L99 I174 A190 C191 E192 S195 S214 W215 G216 G219	H43 Y47 N95 L96 I171 A192 C193 E194 S197 S218 W219 G220 G222	PDBbind-CN: -logKd/Ki=9.62,Ki=0.24nM BindingDB: Ki=0.240000nM

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1lhd, PDBe:1lhd, PDBj:1lhd
PDBsum	1lhd
PubMed	7893672
UniProt	P00734\|THRB_HUMAN Prothrombin (Gene Name=F2)

[Back to BioLiP]