Structure of PDB 1kib Chain H

Receptor sequence
>1kibH (length=89) Species: 129910 (Limnospira maxima) [Search protein sequence]
GDVAAGASVFSANCAACHMGGRNVIVANKTLSKSDLAKYLKGFDDDAVAA
VAYQVTNGKNAMPGFNGRLSPKQIEDVAAYVVDQAEKGW
3D structure
PDB1kib Structure of cytochrome c6 from Arthrospira maxima: an assembly of 24 subunits in a nearly symmetric shell.
ChainH
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC H C14 C17 H18 N23 I25 K29 T30 L31 L36 N60 M62 F65 C14 C17 H18 N23 I25 K29 T30 L31 L36 N60 M62 F65
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0031977 thylakoid lumen
GO:0031979 plasma membrane-derived thylakoid lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kib, PDBe:1kib, PDBj:1kib
PDBsum1kib
PubMed12077429
UniProtP00118|CYC6_LIMMA Cytochrome c6 (Gene Name=petJ)

[Back to BioLiP]