Structure of PDB 1hbt Chain H

Receptor sequence

>1hbtH (length=249) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF

3D structure

• PDB: 1hbt Crystal structure of a peptidyl pyridinium methyl ketone inhibitor with thrombin.
• Chain: H
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 G10 M11 P13 W14 H116 P117 C119 Y134 K135 R137 N156 M203 K204 N209 R210 W211
BS02	peptide	H	F34 Q38 L40 H57 Y60A W60D R73 T74 Y76 I82 Q151 D189 A190 E192 G193 S195 W215 G216	F19 Q24 L26 H43 Y47 W50 R68 T69 Y71 I78 Q148 D191 A192 E194 G195 S197 W219 G220

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1hbt, PDBe:1hbt, PDBj:1hbt
• PDBsum: 1hbt
• PubMed: 7547884
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)