Structure of PDB 1h8i Chain H

Receptor sequence

>1h8iH (length=253) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSG
GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ
FGE

3D structure

• PDB: 1h8i Inhibition of Human Alpha-Thrombin by a Phosphonate Tripeptide Proceeds Via a Metastable Pentacoordinated Phosphorus Intermediate
• Chain: H
• Resolution: 1.75 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	F34 R73 T74 Y76 I82 M84	F19 R68 T69 Y71 I78 M80
BS02	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N158 M205 K206 N211 R212 W213
BS03	PHV	H	H57 Y60A W60D L99 I174 A190 C191 E192 G193 S195 W215 G216 E217 G219	H43 Y47 W50 L96 I173 A194 C195 E196 G197 S199 W221 G222 E223 G224

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1h8i, PDBe:1h8i, PDBj:1h8i
• PDBsum: 1h8i
• PubMed: 11493008
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)