Structure of PDB 1gn1 Chain H |
>1gn1H (length=145) Species: 10090 (Mus musculus) [Search protein sequence] |
LRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYTRILQMEEEYIHQLCED IIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARI VSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILL |
|
PDB | 1gn1 Crystal Structure of the Cct Gamma Apical Domain:: Implications for Substrate Binding to the Eukaryotic Cytosolic Chaperonin |
Chain | H |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
H |
N221 E358 |
N7 E127 |
|
|
|
|