Structure of PDB 1g1x Chain H

Receptor sequence
>1g1xH (length=48) Species: 274 (Thermus thermophilus) [Search protein sequence]
DLRDYRNVEVLKRFLSKILPRTGLSGKEQRILAKTIKRARILGLLPFT
3D structure
PDB1g1x Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain.
ChainH
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna H R64 F81 R30 F47
BS02 rna H K49 I50 Q63 K68 K71 R72 R74 I75 F81 K17 I18 Q29 K34 K37 R38 R40 I41 F47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g1x, PDBe:1g1x, PDBj:1g1x
PDBsum1g1x
PubMed10753109
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]