Structure of PDB 1ffk Chain H |
>1ffkH (length=132) Species: 2238 (Haloarcula marismortui) [Search protein sequence] |
MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLG DKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDE NEDPRGTELKGPIAREVAQRFGSVASAATMIV |
|
PDB | 1ffk The complete atomic structure of the large ribosomal subunit at 2.4 A resolution. |
Chain | H |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
H |
M1 G36 K41 |
M1 G36 K41 |
|
|
|
|