Structure of PDB 1efi Chain H

Receptor sequence

>1efiH (length=103) Species: 562 (Escherichia coli)

APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQV
EVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAIS
MKN

3D structure

• PDB: 1efi Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
• Chain: H
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAT	H	E51 Q56 H57 W88 N90 K91	E51 Q56 H57 W88 N90 K91	MOAD: ic50=12mM

Gene Ontology

Molecular Function

• GO:0090729 toxin activity

Biological Process

• GO:0031640 killing of cells of another organism
• GO:0035821 modulation of process of another organism

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:1efi, PDBe:1efi, PDBj:1efi
• PDBsum: 1efi
• PubMed: 11173465
• UniProt: P32890|ELBP_ECOLX Heat-labile enterotoxin B chain (Gene Name=eltB)