Structure of PDB 1e7p Chain H

Receptor sequence

>1e7pH (length=239) Species: 844 (Wolinella succinogenes)

MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPD
LNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLI
KDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDR
CIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIG
DDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN

3D structure

• PDB: 1e7p A Third Crystal Form of Wolinella Succinogenes Quinol:Fumarate Reductase Reveals Domain Closure at the Site of Fumarate Reduction
• Chain: H
• Resolution: 3.1 Å

Enzymatic activity

• Enzyme Commision number: 1.3.5.1: succinate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	H	V56 C57 R58 G60 C62 G63 C65 C77	V56 C57 R58 G60 C62 G63 C65 C77
BS02	F3S	H	C161 T163 A173 C208 M209 T210 L211 L212 A213 C214	C161 T163 A173 C208 M209 T210 L211 L212 A213 C214
BS03	SF4	H	C151 I152 E153 C154 C157 A174 C218 P219	C151 I152 E153 C154 C157 A174 C218 P219

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:1e7p, PDBe:1e7p, PDBj:1e7p
• PDBsum: 1e7p
• PubMed: 11248702
• UniProt: P17596|FRDB_WOLSU Fumarate reductase iron-sulfur subunit (Gene Name=frdB)