Structure of PDB 1dit Chain H

Receptor sequence

>1ditH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG
E

3D structure

• PDB: 1dit Synthesis, structure, and structure-activity relationships of divalent thrombin inhibitors containing an alpha-keto-amide transition-state mimetic.
• Chain: H
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 M26 P28 W29 F114 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 M11 P13 W14 F111 D113 H116 P117 C119 Y134 K135 R137 N156 M203 K204 R210 W211
BS02	peptide	H	F34 P37 Q38 E39 L40 H57 Y60A K60F R73 T74 Y76 N98 Q151 D189 A190 C191 G193 S195 W215 G216 E217 G219	F19 P23 Q24 E25 L26 H43 Y47 K52 R68 T69 Y71 N95 Q148 D191 A192 C193 G195 S197 W219 G220 E221 G222

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1dit, PDBe:1dit, PDBj:1dit
• PDBsum: 1dit
• PubMed: 8868478
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)