Structure of PDB 1a5g Chain H

Receptor sequence

>1a5gH (length=250) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKEGQPS
VLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGP
FVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFG

3D structure

• PDB: 1a5g Bound structures of novel P3-P1' beta-strand mimetic inhibitors of thrombin.
• Chain: H
• Resolution: 2.06 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 I24 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 K202 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N156 K204 R210 W211
BS02	peptide	H	F34 L65 R67 T74 Y76 K81 I82	F19 L60 R62 T69 Y71 K77 I78
BS03	00L	H	L41 H57 Y60A W60D I174 D189 A190 E192 G193 S195 W215 G216	L27 H43 Y47 W50 I171 D191 A192 E194 G195 S197 W219 G220	PDBbind-CN: -logKd/Ki=10.15,Ki=0.071nM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1a5g, PDBe:1a5g, PDBj:1a5g
• PDBsum: 1a5g
• PubMed: 10212123
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)