Structure of PDB 1a3b Chain H

Receptor sequence

>1a3bH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETKGQ
PSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSG
GPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQ
F

3D structure

• PDB: 1a3b Bifunctional peptide boronate inhibitors of thrombin: crystallographic analysis of inhibition enhanced by linkage to an exosite 1 binding peptide.
• Chain: H
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 N205 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N158 M205 K206 N211 R212 W213
BS02	peptide	H	F34 R67 R73 T74 R75 Y76	F19 R62 R68 T69 R70 Y71
BS03	T29	H	H57 Y60A W60D L99 I174 D189 A190 G193 S195 W215 G216	H43 Y47 W50 L96 I173 D193 A194 G197 S199 W221 G222

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1a3b, PDBe:1a3b, PDBj:1a3b
• PDBsum: 1a3b
• PubMed: 9772168
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)