Structure of PDB 4v8p Chain GY

Receptor sequence
>4v8pGY (length=102) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]
AKRTQKVGITRKYGTRYGASLRKVVKKFEITQHAKYGCPFCGKVAVKRAA
VGIWKCKPCKKIIAGGAWELTTPPAVTAKTTMNRLKKLQEEQAAAAALEK
KN
3D structure
PDB4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
ChainGY
Resolution3.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna GY A2 R4 T5 Q6 K7 V8 G9 I10 R12 K13 T16 R17 Y18 G19 A20 S21 R23 H34 K36 K44 R49 A50 A51 V52 K62 W69 A1 R3 T4 Q5 K6 V7 G8 I9 R11 K12 T15 R16 Y17 G18 A19 S20 R22 H33 K35 K43 R48 A49 A50 V51 K61 W68
BS02 ZN GY C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum4v8p
PubMed22052974
UniProtQ23G98|RL37A_TETTS Large ribosomal subunit protein eL43 (Gene Name=RPL37A)

[Back to BioLiP]