Structure of PDB 4v4g Chain GR

Receptor sequence

>4v4gGR (length=73) Species: 562 (Escherichia coli)

PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRI
LAKTIKRARILGLLPFTEKLVRK

3D structure

• PDB: 4v4g Structural basis for the control of translation initiation during stress.
• Chain: GR
• Resolution: 11.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GR	K23 G48 K49 I50 P52 K61 R64 I65 K68 K71 R74 I75 F81	K8 G33 K34 I35 P37 K46 R49 I50 K53 K56 R59 I60 F66

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 19:06:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'GR', title = 'Structural basis for the control of translation initiation during stress.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='GR', title='Structural basis for the control of translation initiation during stress.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'GR'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='GR')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>