Structure of PDB 4v8p Chain GQ

Receptor sequence

>4v8pGQ (length=157) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

GKTNYSREPANQAKAVKTSASDLRVHFKNTYEVVRAIKGLNLENAKRYLK
AVIDRKRCIPFTRFTGCIGRTAQAHEFGRTQGRWPVKSVKVILGLLDNLS
ANAQAKSLNTANLVIQHGQVNRAQKGRRRTYRAHGRINPYLNSGCHVEIF
AQEVAAK

3D structure

PDB

4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.

Chain

Resolution

3.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GQ	N5 S7 R36 T63 R64 R80 Q120 N122 Q125 H147	N4 S6 R35 T62 R63 R79 Q119 N121 Q124 H146
BS02	rna	GQ	G2 K3 Y6 R8 K18 S20 R25 H27 N30 Y32 K39 R56 K57 R58 R64 F65 T66 G67 C68 G70 R71 A73 Q74 H76 E77 Q82 R84 W85 P86 V87 K88 N99 A102 N103 H118 Q120 V121 R123 R129 T131 Y132 R133 A134 H135 R137 I138 N139 P140 Y141 L142 N143	G1 K2 Y5 R7 K17 S19 R24 H26 N29 Y31 K38 R55 K56 R57 R63 F64 T65 G66 C67 G69 R70 A72 Q73 H75 E76 Q81 R83 W84 P85 V86 K87 N98 A101 N102 H117 Q119 V120 R122 R128 T130 Y131 R132 A133 H134 R136 I137 N138 P139 Y140 L141 N142

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	P0DJ16\|RL17_TETTS Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]