Structure of PDB 4v8p Chain GO

Receptor sequence

>4v8pGO (length=153) Species: 5911 (Tetrahymena thermophila)

VSLRLQKRLAASVLKCGQKRLWLDPNESSEISMANSRASIRKLIKDGLVM
KRSTVIHSRSRARAFLEAKRKGRHTGSGKRKGTRNARMPTKVLWMRRQRV
LRRLLRKYRAAKKIDKHQYHEFYLGSKGNLYKNKTVLIEAIHVSKADKIK
SDK

3D structure

• PDB: 4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.
• Chain: GO
• Resolution: 3.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GO	V2 S3 L4 R5 K8 R9 L10 K16 G18 Q19 K20 R21 W23 L24 P26 S37 R38 R42 R53 T55 V56 I57 H58 S59 R60 S61 R62 R64 R71 R74 H75 G77 S78 G79 K80 R81 K82 G83 T84 R85 M89 K92 W95 M96 R97 R100 V101 R103 R104 R110 K117 H118 Y120 H121 Y124 L125 K128 G129 N130 L131 N134 K135	V1 S2 L3 R4 K7 R8 L9 K15 G17 Q18 K19 R20 W22 L23 P25 S36 R37 R41 R52 T54 V55 I56 H57 S58 R59 S60 R61 R63 R70 R73 H74 G76 S77 G78 K79 R80 K81 G82 T83 R84 M88 K91 W94 M95 R96 R99 V100 R102 R103 R109 K116 H117 Y119 H120 Y123 L124 K127 G128 N129 L130 N133 K134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
• PDBsum: 4v8p
• PubMed: 22052974
• UniProt: P0DJ60|RL19_TETTS Large ribosomal subunit protein eL19 (Gene Name=RPL19)