Structure of PDB 4v8p Chain GM

Receptor sequence

>4v8pGM (length=300) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

GFVKVLKTKAYFKRFQTKYRRRREGLTDYYARKRLIIQDKDKYNTPKYRL
VARATNTRIIAQIVYATLKCDRVLCAADSYELKRFGVSTGLASYAAAYAT
GLLLARRLLKQIGLDTVYAGQTKVDGAYFNVDEDQKEKKPFKAILDAGLV
RTTTGNRVFGVLKGACDGGINIPHSESRFPGYVRASDEGESSKYKPEDHK
ARIFGKHIDAYMKHLKGQSNEAFQKQFSKWSKTLEAAKVDSVEKLFTKVH
AEIRKNPERVKSTKKNDKPKRDHKKFYPTKLTAAQRKDRVKTKFQLALSQ

3D structure

PDB

4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.

Chain

Resolution

3.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GM	F13 K14 T18 Y20 R21 R22 R24 T28 R33 R50 R54 T56 N57 T58 I61 Q63 L69 K70 C71 D72 R73 V74 Y81 T90 G91 S94 Y95 R152 T154 T155 N157 R158 R203 H208 I209 Y212 H215 K226 Q227 F228 S229 K230 R260 K265 N267 P270 H274 K275 F277 Y278 P279 K281 L282 R287 R290	F12 K13 T17 Y19 R20 R21 R23 T27 R32 R49 R53 T55 N56 T57 I60 Q62 L68 K69 C70 D71 R72 V73 Y80 T89 G90 S93 Y94 R151 T153 T154 N156 R157 R202 H207 I208 Y211 H214 K225 Q226 F227 S228 K229 R259 K264 N266 P269 H273 K274 F276 Y277 P278 K280 L281 R286 R289
BS02	rna	GM	F3 K5 V6 L7 K8 K10 Y12 K14 R15 F16 Q17 K19 R23 T28 D29 Y31 R35 L36 I38 K43 Y44 T46 K48 Y49 I113 K140 P141 F142 I145 L146 L150 T153 H175 S176 S178 R179	F2 K4 V5 L6 K7 K9 Y11 K13 R14 F15 Q16 K18 R22 T27 D28 Y30 R34 L35 I37 K42 Y43 T45 K47 Y48 I112 K139 P140 F141 I144 L145 L149 T152 H174 S175 S177 R178

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	Q231U7\|RL5_TETTS Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]