Structure of PDB 4v8p Chain GL

Receptor sequence

>4v8pGL (length=203) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

GAYKYLEELWRKKQSDLMSFILRLRTWEYRQLPVIHKASRSSRPDKARKL
GYKNKDGYAIWRVRVRRGGRKRPVSKGIVYGKPSSVGINQLKFARNLRSC
AEERVGKRVPELRVLNSYWVGQDGTYKFYEVILADPSHNAIRNDPRINWI
CESAHKHRELRGLTSAGRKGRGLRVKGHRAKSLRTSRKGNWRARQMLKLR
RYR

3D structure

PDB

4v8p Crystal Structure of the Eukaryotic 60S Ribosomal Subunit in Complex with Initiation Factor 6.

Chain

Resolution

3.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	GL	K38 W62 E112 L113 D136	K37 W61 E111 L112 D135
BS02	rna	GL	G2 Y4 K5 R12 K14 Q15 W28 R31 V35 S40 R41 R44 P45 K47 R49 K50 L51 K54 N55 K56 D57 R67 R68 G69 R71 K72 P74 S76 K77 G78 I79 Y81 G82 K83 P84 S85 S86 N90 Q91 L92 K93 F94 A95 R96 N97 L98 E104 R105 K108 P111 W120 G125 T126 S138 N140 A141 N144 R147 W150 H156 K157 H158 L161 R162 L164 S166 R169 K170 G171 R172 G173 R175 K177 G178 H179 R180 K182 L184 R185 S187 R188 K189 W192 R193 R195 K199 R201 R204	G1 Y3 K4 R11 K13 Q14 W27 R30 V34 S39 R40 R43 P44 K46 R48 K49 L50 K53 N54 K55 D56 R66 R67 G68 R70 K71 P73 S75 K76 G77 I78 Y80 G81 K82 P83 S84 S85 N89 Q90 L91 K92 F93 A94 R95 N96 L97 E103 R104 K107 P110 W119 G124 T125 S137 N139 A140 N143 R146 W149 H155 K156 H157 L160 R161 L163 S165 R168 K169 G170 R171 G172 R174 K176 G177 H178 R179 K181 L183 R184 S186 R187 K188 W191 R192 R194 K198 R200 R203

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v8p, PDBe:4v8p, PDBj:4v8p
PDBsum	4v8p
PubMed	22052974
UniProt	Q22A30\|RL15_TETTS Large ribosomal subunit protein eL15 (Gene Name=RPL15)

[Back to BioLiP]